Lyophilized Peptide Long R3 IGF-1 Top Quality IGF-1 LR3 Increase Protein

Delivery term:The date of payment from buyers deliver within days
  • Price:

    Negotiable

  • minimum:

  • Total supply:

  • Delivery term:

    The date of payment from buyers deliver within days

  • seat:

    Beijing

  • Validity to:

    Long-term effective

  • Last update:

    2017-12-12 19:58

  • Browse the number:

    29

Send an inquiries
Company Profile
Wuhan Pharma Chemical Co., Ltd.
Contactaixin:

farmkemi(Mr.)  

telephone:

Arrea:

Beijing

Address:

No. 3 Zhongnan Road, Wuchang, Wuhan, Hubei, China (430000)

Website:

http://farmkemi.zhuchengdeliyuan.com/

Product details

Model Number: IGF-1 LR3 Brand Name: Biopharm Key Specifications/Special Features: SpecificationName: IGF-1 LR3Synonyms: long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1CAS No.: 946870-92-4Molecular formula: C400H625N111O115S9Molecular mass: 9117.5 Da (g/mol)Amino acid sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSAPurityIGF-1 LR3 has a peptide purity level that exceeds 95.0% as determined by HPLC and MS Product Name IGF-1 LR3 Other Name Long R3 IGF-1 Chemical Name Long Arg3 IGF-1 Abb. Name: LR3 IGF CAS No. 946870-92-4 Molecular Formula C400H625N111O115S9 Product Type Lyophilized Powder Color White Standard Pharmaceutical Grade Package 1 mg/vial
0.1 mg/vial
Shipping Information:
  • FOB Port: Shenzhen
  • Lead Time: 3 - 5 days
  • Dimensions per Unit: 15 × 15 × 15 Centimeters
  • Weight per Unit: 0.5 Kilograms
  • Units per Export Carton: 10
  • Export Carton Dimensions L/W/H: 25 × 25 × 25 Centimeters
  • Export Carton Weight: 1 Kilograms
Main Export Markets:
  • Asia
  • Australasia
  • Central/South America
  • Eastern Europe
  • Mid East/Africa
  • North America
  • Western Europe